TCIRG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Product Discontinued
View other related TCIRG1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89333
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TCIRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCIRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP1-89333 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22245629).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCIRG1 Antibody

  • a3
  • Atp6i
  • ATP6N1C
  • ATP6N1Cspecific 116-kDa vacuolar proton pump subunit
  • ATP6V0A3T-cell immune response cDNA 7
  • OC-116 kDa
  • OC116
  • OC-116
  • OC-116kDa
  • OC116Vph1
  • OPTB1
  • Osteoclastic proton pump 116 kDa subunit
  • Stv1
  • T-cell immune regulator 1
  • T-cell immune response cDNA7 protein
  • T-cell, immune regulator 1
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • TCIRG1
  • TIRC7
  • TIRC7ATPase, H+ transporting, 116kD
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • V-ATPase 116 kDa isoform a3
  • V-ATPase 116-kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 3
  • V-type proton ATPase 116 kDa subunit a

Background

TCIRG1 - T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a isoform 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15896
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89330
Species: Hu
Applications: IHC, IHC-P
H00005355-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-90299
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB

Publications for TCIRG1 Antibody (NBP1-89333)(4)

Reviews for TCIRG1 Antibody (NBP1-89333) (0)

There are no reviews for TCIRG1 Antibody (NBP1-89333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCIRG1 Antibody (NBP1-89333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCIRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCIRG1