TCIRG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCIRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCIRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCIRG1 Protein (NBP1-89333PEP)
Publications
Read Publication using
NBP1-89333 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22245629).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCIRG1 Antibody

  • a3
  • Atp6i
  • ATP6N1C
  • ATP6N1Cspecific 116-kDa vacuolar proton pump subunit
  • ATP6V0A3T-cell immune response cDNA 7
  • OC-116 kDa
  • OC116
  • OC-116
  • OC-116kDa
  • OC116Vph1
  • OPTB1
  • Osteoclastic proton pump 116 kDa subunit
  • Stv1
  • T-cell immune regulator 1
  • T-cell immune response cDNA7 protein
  • T-cell, immune regulator 1
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • TCIRG1
  • TIRC7
  • TIRC7ATPase, H+ transporting, 116kD
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • V-ATPase 116 kDa isoform a3
  • V-ATPase 116-kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 3
  • V-type proton ATPase 116 kDa subunit a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-62539
Species: Hu
Applications: WB
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for TCIRG1 Antibody (NBP1-89333)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TCIRG1 Antibody (NBP1-89333) (0)

There are no reviews for TCIRG1 Antibody (NBP1-89333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCIRG1 Antibody (NBP1-89333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCIRG1 Products

Bioinformatics Tool for TCIRG1 Antibody (NBP1-89333)

Discover related pathways, diseases and genes to TCIRG1 Antibody (NBP1-89333). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCIRG1 Antibody (NBP1-89333)

Discover more about diseases related to TCIRG1 Antibody (NBP1-89333).
 

Pathways for TCIRG1 Antibody (NBP1-89333)

View related products by pathway.

PTMs for TCIRG1 Antibody (NBP1-89333)

Learn more about PTMs related to TCIRG1 Antibody (NBP1-89333).

Blogs on TCIRG1

There are no specific blogs for TCIRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCIRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCIRG1
Entrez