TCIRG1 Antibody


Immunocytochemistry/ Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TCIRG1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RPADRQEENKAGLLDLPDASVNGWSSDEEKAGGLDDEEEAELVPSEVLMHQAIHTI
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCIRG1 Protein (NBP1-89333PEP)
Read Publications using
NBP1-89333 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22245629).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TCIRG1 Antibody

  • a3
  • Atp6i
  • ATP6N1C
  • ATP6N1Cspecific 116-kDa vacuolar proton pump subunit
  • ATP6V0A3T-cell immune response cDNA 7
  • OC-116 kDa
  • OC116
  • OC-116
  • OC-116kDa
  • OC116Vph1
  • OPTB1
  • Osteoclastic proton pump 116 kDa subunit
  • Stv1
  • T-cell immune regulator 1
  • T-cell immune response cDNA7 protein
  • T-cell, immune regulator 1
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein A3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein aisoform 3
  • T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
  • TCIRG1
  • TIRC7
  • TIRC7ATPase, H+ transporting, 116kD
  • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 3
  • vacuolar proton translocating ATPase 116 kDa subunit A
  • V-ATPase 116 kDa isoform a3
  • V-ATPase 116-kDa
  • Vph1
  • V-type proton ATPase 116 kDa subunit a isoform 3
  • V-type proton ATPase 116 kDa subunit a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB

Publications for TCIRG1 Antibody (NBP1-89333)(3)

We have publications tested in 2 confirmed species: Mouse, Xenopus.

We have publications tested in 2 applications: ICC/IF, IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for TCIRG1 Antibody (NBP1-89333) (0)

There are no reviews for TCIRG1 Antibody (NBP1-89333). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCIRG1 Antibody (NBP1-89333) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TCIRG1 Products

Bioinformatics Tool for TCIRG1 Antibody (NBP1-89333)

Discover related pathways, diseases and genes to TCIRG1 Antibody (NBP1-89333). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCIRG1 Antibody (NBP1-89333)

Discover more about diseases related to TCIRG1 Antibody (NBP1-89333).

Pathways for TCIRG1 Antibody (NBP1-89333)

View related products by pathway.

PTMs for TCIRG1 Antibody (NBP1-89333)

Learn more about PTMs related to TCIRG1 Antibody (NBP1-89333).

Research Areas for TCIRG1 Antibody (NBP1-89333)

Find related products by research area.

Blogs on TCIRG1

There are no specific blogs for TCIRG1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TCIRG1 Antibody and receive a gift card or discount.


Gene Symbol TCIRG1