TCFL5 Antibody (1F2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: TCFL5 Antibody (1F2) [H00010732-M01] - Analysis of monoclonal antibody to TCFL5 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: TCFL5 Antibody (1F2) [H00010732-M01] - Detection limit for recombinant GST tagged TCFL5 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1F2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TCFL5 Antibody (1F2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse TCFL5 Antibody (1F2) - Azide and BSA Free (H00010732-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TCFL5 (NP_006593, 418 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPAQGSLQSSPSMEIK
• Specificity: TCFL5 - transcription factor-like 5 (basic helix-loop-helix)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TCFL5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCFL5 Antibody (1F2) - Azide and BSA Free

• bHLHe82
• Cha transcription factor
• CHA
• CHAMGC46135
• E2BP1
• E2BP-1HPV-16 E2 binding protein 1
• Figlb
• HPV-16 E2-binding protein 1
• transcription factor-like 5 (basic helix-loop-helix)
• transcription factor-like 5 protein

Background

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCFL5
• Entrez:
  • 10732(Human)
• OMIM:
  • 604745(Human)
• Uniprot:
  • NP_006593(Human)