TCEB2 Recombinant Protein Antigen

Images

 
There are currently no images for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TCEB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TCEB2

Source: E. coli

Amino Acid Sequence: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELOB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17944.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCEB2 Recombinant Protein Antigen

  • 18-kD subunit
  • EloB
  • Elongin 18 kDa subunit
  • Elongin-B
  • RNA polymerase II transcription factor SIII p18 subunit
  • RNA polymerase II transcription factor SIII subunit B
  • SIII p18
  • transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
  • transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
  • transcription elongation factor B polypeptide 2

Background

TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP2-45411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-45210
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP3-45890
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC
AF3434
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-20380
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87401
Species: Hu, Mu, Rt, RM
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP) (0)

There are no publications for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP) (0)

There are no reviews for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCEB2 Products

Research Areas for TCEB2 Recombinant Protein Antigen (NBP3-17944PEP)

Find related products by research area.

Blogs on TCEB2

There are no specific blogs for TCEB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TCEB2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ELOB