TC21/R-Ras2 Antibody Summary
| Immunogen |
RRAS2 (NP_036382.2, 1 a.a. - 204 a.a.) full-length human protein. MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
| Specificity |
Reacts with related RAS viral (r-ras) oncogene homolog 2. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RRAS2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TC21/R-Ras2 Antibody
Background
RRAS2 (Related RAS viral oncogene homolog 2) is a member of the Ras superfamily. It is a GTP-binding protein with GTPase activity. It might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins. RRAS2 has high oncogenic potential and is mutated in some human tumors and overexpressed in breast cancer cell lines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Publications for TC21/R-Ras2 Antibody (H00022800-D01P) (0)
There are no publications for TC21/R-Ras2 Antibody (H00022800-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TC21/R-Ras2 Antibody (H00022800-D01P) (0)
There are no reviews for TC21/R-Ras2 Antibody (H00022800-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TC21/R-Ras2 Antibody (H00022800-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TC21/R-Ras2 Products
Research Areas for TC21/R-Ras2 Antibody (H00022800-D01P)
Find related products by research area.
|
Blogs on TC21/R-Ras2