TBX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TBX2 Antibody [NBP1-89459] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBX2 Antibody - BSA Free (NBP1-89459) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TBX2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry Reported in scientific literature (PMID: 23720046)
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TBX2 Protein (NBP1-89459PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23720046).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBX2 Antibody - BSA Free

• FLJ10169
• T-box 2
• T-box protein 2
• T-box transcription factor TBX2
• TBX2

Background

TBX2 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBX2 Antibody (NBP1-89459)(3)

Publications using NBP1-89459

• Schmidt C, Deyett A, Ilmer T et al. Multi-chamber cardioids unravel human heart development and cardiac defects Cell 2023-11-16 [PMID: 38029745]
• Saadi I, Das P, Zhao M et al. Msx1 and Tbx2 antagonistically regulate Bmp4 expression during the bud-to-cap stage transition in tooth development. Development 2013-07-01 [PMID: 23720046] (IF/IHC, Mouse)
• Schneider MA, Scheffer KD, Bund T et al. The Transcription Factors TBX2 and TBX3 Interact with Human Papillomavirus 16 (HPV16) L2 and Repress the Long Control Region of HPVs. J Virol 2013-04-01 [PMID: 23388722]

Bioinformatics

• Gene Symbol: TBX2