Home » TBC1D2B » TBC1D2B Antibodies » TBC1D2B Antibody

TBC1D2B Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TBC1D2B Antibody [NBP2-88417] - WB Suggested Anti-TBC1D2B Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole CellTBC1D2B is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells
Western Blot: TBC1D2B Antibody [NBP2-88417] - WB Suggested Anti-TBC1D2B Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole CellTBC1D2B is strongly supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TBC1D2B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of TBC1D2B. Peptide sequence: EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D2B Antibody

  • TBC1 domain family, member 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CIB2 Antibody
H00010518-A01
Western Blot: CIB2 Antibody [H00010518-A01] - Detection against Immunogen (37 KDa).
Chromatin Immunoprecipitation: CIB2 Antibody [H00010518-A01] - Analysis of CIB2 in 5dpf zebrafish retina using anti-CIB2 antibody (red) and DAPI (blue). Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Ze
Applications: WB, ELISA
ARF6 Antibody
(JF101-2)
NBP2-67165
Western Blot: ARF6 Antibody (JF101-2) [NBP2-67165] - Analysis of ARF6 on human liver lysates using anti-ARF6 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: ARF6 Antibody (JF101-2) [NBP2-67165] - Staining ARF6 in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ARF6 Antibody (JF101-2) [NBP2-67165] - Immunohistochemical analysis of paraffin-embedded human stomach tissue using anti-ARF6 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1/200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
RABGAP1 Antibody
NBP2-56581
Western Blot: RABGAP1 Antibody [NBP2-56581] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: RABGAP1 Antibody [NBP2-56581] - Staining of human cell line MCF7 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RABGAP1 Antibody [NBP2-56581] - Staining in human thyroid gland and liver tissues using anti-RABGAP1 antibody. Corresponding RABGAP1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TMED3 Antibody
NBP2-94321
Western Blot: TMED3 Antibody [NBP2-94321] - Analysis of extracts of various cell lines, using TMED3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/Immunofluorescence: TMED3 Antibody [NBP2-94321] - Analysis of A431 cells using TMED3 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TMED3 Antibody [NBP2-94321] - Paraffin-embedded rat kidney using TMED3.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, IHC, IHC-P
RCAN2 Antibody
NBP1-76995
Western Blot: RCAN2 Antibody [NBP1-76995] - 3T3 cell lysate with RCAN2 antibody at (A) 1 and (B) 2 ug/mL.
Immunocytochemistry/Immunofluorescence: RCAN2 Antibody [NBP1-76995] - Immunofluorescence of RCAN2 in mouse brain tissue with RCAN2 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: RCAN2 Antibody [NBP1-76995] - Mouse brain tissue with RCAN2 antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MRG15 Antibody
NB100-1307
Western Blot: MRG15 Antibody [NB100-1307] - staining of NIH3T3 (A) and HepG2 (B) lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Immunohistochemistry-Paraffin: MRG15 Antibody [NB100-1307] - staining of paraffin embedded Human Uterus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining. This data was obtained using a previous batch.
Western Blot: MRG15 Antibody [NB100-1307] - Analysis of Mouse Liver lysate (35ug protein in RIPA buffer) using NB100-1307 at 0.1 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
ADAMTS7 Antibody
NBP2-38539
Immunohistochemistry: ADAMTS7 Antibody [NBP2-38539] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, KD
p57 Kip2 Antibody
NBP1-89917
Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.
Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SLCO6A1 Antibody [NBP2-49118] - Staining in human testis and endometrium tissues using anti-SLCO6A1 antibody. Corresponding SLCO6A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(44 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
PTP-MEG2/PTPN9
Antibody (291835) [Un ...
MAB2668
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, TS1 mouse helper T cell line, CTLL‑2 mouse cytotoxic T cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat PTP-MEG2 Monoclonal Antibody (Catalog # MAB2668) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PTP-MEG2 at approximately 68 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB

Fumarylacetoacetate hy
NBP2-48736
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining in human liver and pancreas tissues using anti-FAH antibody. Corresponding FAH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-FAH antibody NBP2-48736 (A) shows similar protein distribution across tissues to independent antibody NBP2-48807 (B).
Western Blot: Fumarylacetoacetate hydrolase Antibody [NBP2-48736] - Analysis using Anti-FAH antibody NBP2-48736 (A) shows similar pattern to independent antibody NBP2-48807 (B).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IDH3A Antibody
(OTI2F11)
NBP2-02158
Western Blot: IDH3A Antibody (2F11) [NBP2-02158] Analysis of extracts (35ug) from 9 different cell lines by using anti-IDH3A monoclonal antibody.
Immunocytochemistry/Immunofluorescence: IDH3A Antibody (2F11) [NBP2-02158] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY IDH3A.
Immunohistochemistry-Paraffin: IDH3A Antibody (2F11) [NBP2-02158] - Staining of paraffin-embedded liver tissue using anti-IDH3A mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
RCN2 Antibody
NBP2-32010
Western Blot: RCN2 Antibody [NBP2-32010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human cerebral cortex.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MTHFS Antibody
NBP2-58656
Western Blot: MTHFS Antibody [NBP2-58656] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/Immunofluorescence: MTHFS Antibody [NBP2-58656] - Staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: MTHFS Antibody [NBP2-58656] - Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DNAJA4 Antibody
(4B4-1F2)
H00055466-M01
Western Blot: DNAJA4 Antibody (4B4-1F2) [H00055466-M01] - DNAJA4 monoclonal antibody (M01), clone 4B4-1F2 Analysis of DNAJA4 expression in HeLa.
Immunocytochemistry/Immunofluorescence: DNAJA4 Antibody (4B4-1F2) [H00055466-M01] - Analysis of monoclonal antibody to DNAJA4 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DNAJA4 Antibody (4B4-1F2) [H00055466-M01] - Analysis of monoclonal antibody to DNAJA4 on formalin-fixed paraffin-embedded human tonsil tissue. Antibody concentration 5 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TBC1D2B Antibody
NBP2-88417
TBC1D2B Antibody
Species: Hu, Mu, Rt, Gp, Rb
Applications: WB

Publications for TBC1D2B Antibody (NBP2-88417) (0)

There are no publications for TBC1D2B Antibody (NBP2-88417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D2B Antibody (NBP2-88417) (0)

There are no reviews for TBC1D2B Antibody (NBP2-88417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D2B Antibody (NBP2-88417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TBC1D2B Products

Bioinformatics Tool for TBC1D2B Antibody (NBP2-88417)

Discover related pathways, diseases and genes to TBC1D2B Antibody (NBP2-88417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TBC1D2B Antibody (NBP2-88417)

View related products by pathway.

Blogs on TBC1D2B

There are no specific blogs for TBC1D2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D2B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TBC1D2B