TBC1D2B Antibody

Images

 
Western Blot: TBC1D2B Antibody [NBP2-88417] - WB Suggested Anti-TBC1D2B Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole CellTBC1D2B is strongly supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D2B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of TBC1D2B. Peptide sequence: EDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEEEKLVAKVRALD The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D2B Antibody

  • TBC1 domain family, member 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-56581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94321
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1307
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-38539
Species: Hu, Mu
Applications: IHC, IHC-P, KD
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2668
Species: Hu, Mu, Rt
Applications: WB
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02158
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58656
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055466-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-88417
Species: Hu, Mu, Rt, Gp, Rb
Applications: WB

Publications for TBC1D2B Antibody (NBP2-88417) (0)

There are no publications for TBC1D2B Antibody (NBP2-88417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D2B Antibody (NBP2-88417) (0)

There are no reviews for TBC1D2B Antibody (NBP2-88417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D2B Antibody (NBP2-88417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D2B Products

Bioinformatics Tool for TBC1D2B Antibody (NBP2-88417)

Discover related pathways, diseases and genes to TBC1D2B Antibody (NBP2-88417). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TBC1D2B Antibody (NBP2-88417)

View related products by pathway.

Blogs on TBC1D2B

There are no specific blogs for TBC1D2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D2B