TBC1D22A Antibody


Western Blot: TBC1D22A Antibody [NBP2-88413] - WB Suggested Anti-TBC1D22A Antibody. Titration: 1.0 ug/ml. Positive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that TBC1D22A is expressed in ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TBC1D22A Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of TBC1D22A. Peptide sequence: MTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQ The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for TBC1D22A Antibody

  • HSC79E021
  • TBC1 domain family member 22A
  • TBC1 domain family, member 22A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Flow, ICC/IF, In vitro
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for TBC1D22A Antibody (NBP2-88413) (0)

There are no publications for TBC1D22A Antibody (NBP2-88413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D22A Antibody (NBP2-88413) (0)

There are no reviews for TBC1D22A Antibody (NBP2-88413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D22A Antibody (NBP2-88413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TBC1D22A Products

Bioinformatics Tool for TBC1D22A Antibody (NBP2-88413)

Discover related pathways, diseases and genes to TBC1D22A Antibody (NBP2-88413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D22A Antibody (NBP2-88413)

Discover more about diseases related to TBC1D22A Antibody (NBP2-88413).

Pathways for TBC1D22A Antibody (NBP2-88413)

View related products by pathway.

Blogs on TBC1D22A

There are no specific blogs for TBC1D22A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBC1D22A Antibody and receive a gift card or discount.


Gene Symbol TBC1D22A