TBC1D22A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TBC1D22A Antibody [NBP1-86811] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: TBC1D22A Antibody [NBP1-86811] - Staining of human adrenal gland shows moderate cytoplasmic and membranous positivity in cortical cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D22A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HPASGYVQGINDLVTPFFVVFICEYIEAEEVDTVDVSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKVKMLEELVSRIDEQVHRHLDQHEVRYLQFAFRWMNNLLMREVPLRCTIRLWDTYQSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D22A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBC1D22A Protein (NBP1-86811PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D22A Antibody

  • HSC79E021
  • TBC1 domain family member 22A
  • TBC1 domain family, member 22A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59480
Species: Hu
Applications: WB
NBP2-22155
Species: Hu, Bv, Pm, Mu(-), Rt(-)
Applications: WB, EM, ICC/IF, IP
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56446
Species: Hu, Mu, Rt
Applications: WB
NBP1-28745
Species: Hu
Applications: WB, IHC, IP
NBP2-14047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89712
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
H00081876-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-58342
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74048
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89362
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84100
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86811
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TBC1D22A Antibody (NBP1-86811) (0)

There are no publications for TBC1D22A Antibody (NBP1-86811).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D22A Antibody (NBP1-86811) (0)

There are no reviews for TBC1D22A Antibody (NBP1-86811). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBC1D22A Antibody (NBP1-86811) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBC1D22A Products

Bioinformatics Tool for TBC1D22A Antibody (NBP1-86811)

Discover related pathways, diseases and genes to TBC1D22A Antibody (NBP1-86811). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D22A Antibody (NBP1-86811)

Discover more about diseases related to TBC1D22A Antibody (NBP1-86811).
 

Pathways for TBC1D22A Antibody (NBP1-86811)

View related products by pathway.

Blogs on TBC1D22A

There are no specific blogs for TBC1D22A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D22A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D22A