TAS2R16 Antibody - BSA Free

Western Blot: TAS2R16 Antibody [NBP3-09490] - Western blot analysis of TAS2R16 in Placenta as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAS2R16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAS2R16 Antibody - BSA Free (NBP3-09490) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS2R16 (NP_058641). Peptide sequence TILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAS2R16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAS2R16 Antibody - BSA Free

• T2R16candidate taste receptor T2R16
• taste receptor type 2 member 16
• taste receptor, type 2, member 16

Background

TAS2R16 encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily. These family members are specifically expressed by taste receptor cells of the tongue and palate epithelia. Each of these apparently intronless genes encodes a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception. FUNCTION: Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in a subset of gustducin-positive taste receptor cells of the tongue. POLYMORPHISM: The Lys-172 polymorphism in TAS2R16 is associated with genetic susceptibility to alcoholism [MIM:103780]. MISCELLANEOUS: Several bitter taste receptors are expressed in a single taste receptor cell. MISCELLANEOUS: Confers bitter perception of salicin to non-taster mice. Useful Links; The Human Olfactory Data Exploratorium: HORDE; Olfactory Receptor Data Base: ORDB; Transmembrane Analysis: TM analysis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAS2R16