TARSH Recombinant Protein Antigen

Images

 
There are currently no images for TARSH Recombinant Protein Antigen (NBP2-48811PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TARSH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TARSH.

Source: E. coli

Amino Acid Sequence: VEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISDAL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABI3BP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48811.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TARSH Recombinant Protein Antigen

  • ABI family, member 3 (NESH) binding protein
  • ABI gene family member 3-binding protein
  • DKFZP586L2024
  • FLJ41743
  • Nesh-binding protein
  • NeshBP
  • NESHBPABI gene family, member 3 (NESH) binding protein
  • target of Nesh-SH3
  • Tarsh
  • TARSHFLJ41754

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30583
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00056996-R01
Species: Hu
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for TARSH Recombinant Protein Antigen (NBP2-48811PEP) (0)

There are no publications for TARSH Recombinant Protein Antigen (NBP2-48811PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TARSH Recombinant Protein Antigen (NBP2-48811PEP) (0)

There are no reviews for TARSH Recombinant Protein Antigen (NBP2-48811PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TARSH Recombinant Protein Antigen (NBP2-48811PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TARSH Products

Bioinformatics Tool for TARSH Recombinant Protein Antigen (NBP2-48811PEP)

Discover related pathways, diseases and genes to TARSH Recombinant Protein Antigen (NBP2-48811PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TARSH Recombinant Protein Antigen (NBP2-48811PEP)

Discover more about diseases related to TARSH Recombinant Protein Antigen (NBP2-48811PEP).
 

Pathways for TARSH Recombinant Protein Antigen (NBP2-48811PEP)

View related products by pathway.

PTMs for TARSH Recombinant Protein Antigen (NBP2-48811PEP)

Learn more about PTMs related to TARSH Recombinant Protein Antigen (NBP2-48811PEP).

Blogs on TARSH

There are no specific blogs for TARSH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TARSH Antibody
NBP2-48811
TARSH Antibody
NBP2-48811

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TARSH Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABI3BP