TARS Antibody (1A9) - Azide and BSA Free

Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01] - TARS expression increases with stage of ovarian cancer. Tissues were stained for TARS by immunohistochemistry and counter-stained with Mayers' hematoxylin. Images were scored blindly by 2 independent investigators and tumor identification was later confirmed by a pathologist (SLM). Shown are 10x images from (1) normal ovary and examples of TARS score increasing with extent of disease (2-4), Bar=100 um. Image collected and cropped by CiteAb from the following publication (bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01] - TARS expression co-localized with VEGF and in leukocytes. Tissues were stained by IHC. Shown are 40x images of serial sections stained with TARS. Image collected and cropped by CiteAb from the following publication (bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license.

Western Blot: TARS Antibody (1A9) [H00006897-M01] - TARS monoclonal antibody (M01), clone 1A9 Analysis of TARS expression in HeLa.

Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01] - Analysis of monoclonal antibody to TARS on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.

Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] - TARS expression co-localized with VEGF & in leukocytes. Tissues were stained by IHC as in Figure 2. Shown are 40x images of serial sections stained with (A,B) No primary Ab as a negative control (C,D) TARS or (E,F) VEGF. Bottom panels show examples of TARS staining in infiltrating leukocytes. Bar = 50 μm. See Additional File 3 for supporting images. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] - TARS expression increases with stage of ovarian cancer. A. Tissues were stained for TARS by immunohistochemistry & counter-stained with Mayers’ hematoxylin. Images were scored blindly by 2 independent investigators & tumor identification was later confirmed by a pathologist (SLM). Shown are 10x images from (1) normal ovary & examples of TARS score increasing with extent of disease (2–4), Bar = 100 μm. B. Graph representing average scores where high stage is ≥ stage 3; statistical significance determined by one-way ANOVA. For more detailed statistics, see Table 1 for Pearson’s Correlations. C. Shown is a graph of individual patient TARS tumor scores grouped according to FIGO stage of disease (i.e. Stage 3.75 = FIGO 3C). Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1A9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TARS Antibody (1A9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TARS (NP_689508, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
• Specificity: TARS - threonyl-tRNA synthetase
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TARS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TARS Antibody (1A9) - Azide and BSA Free

• cytoplasmic
• EC 6.1.1.3
• MGC9344
• Threonine--tRNA ligase
• threonyl-tRNA synthetase
• threonyl-tRNA synthetase, cytoplasmic

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Threonyl-tRNA synthetase belongs to the class-II aminoacyl-tRNA synthetase family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TARS Antibody (H00006897-M01)(1)

Publication using H00006897-M01

• Wellman TL, Eckenstein M, Wong C et al. Threonyl-tRNA synthetase overexpression correlates with angiogenic markers and progression of human ovarian cancer BMC Cancer 2014-08-27 [PMID: 25163878]

Bioinformatics

• Gene Symbol: TARS1
• Entrez:
  • 6897(Human)
• OMIM:
  • 187790(Human)
• Uniprot:
  • NP_689508(Human)