TAPP1/PLEKHA1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAPP1/PLEKHA1 Antibody [NBP2-57495] - Staining of human cell line HaCaT shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAPP1/PLEKHA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQ
Specificity
Specificity of human TAPP1/PLEKHA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAPP1/PLEKHA1 Recombinant Protein Antigen (NBP2-57495PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TAPP1/PLEKHA1 Antibody

  • family A (phosphoinositide bindingspecific) member 1
  • PH domain-containing family A member 1
  • pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 1
  • PLEKHA1
  • TAPP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: WB, IHC
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB2916
Species: Hu
Applications: WB, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF7024
Species: Hu, Mu
Applications: WB
NBP1-07010
Species: Hu, Rt, Pm
Applications: WB, ELISA, ICC/IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90655
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57495
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for TAPP1/PLEKHA1 Antibody (NBP2-57495) (0)

There are no publications for TAPP1/PLEKHA1 Antibody (NBP2-57495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAPP1/PLEKHA1 Antibody (NBP2-57495) (0)

There are no reviews for TAPP1/PLEKHA1 Antibody (NBP2-57495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAPP1/PLEKHA1 Antibody (NBP2-57495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAPP1/PLEKHA1 Products

Bioinformatics Tool for TAPP1/PLEKHA1 Antibody (NBP2-57495)

Discover related pathways, diseases and genes to TAPP1/PLEKHA1 Antibody (NBP2-57495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAPP1/PLEKHA1 Antibody (NBP2-57495)

Discover more about diseases related to TAPP1/PLEKHA1 Antibody (NBP2-57495).
 

Pathways for TAPP1/PLEKHA1 Antibody (NBP2-57495)

View related products by pathway.

PTMs for TAPP1/PLEKHA1 Antibody (NBP2-57495)

Learn more about PTMs related to TAPP1/PLEKHA1 Antibody (NBP2-57495).

Blogs on TAPP1/PLEKHA1

There are no specific blogs for TAPP1/PLEKHA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAPP1/PLEKHA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA1