Recombinant Human TAP1 GST (N-Term) Protein

SDS-Page: Recombinant Human TAP1 Protein [H00006890-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human TAP1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 241-350 of Human TAP1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: TAP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.73 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAP1 GST (N-Term) Protein

• ABC Transporter, MHC 1
• ABC17
• ABCB2
• ABCB2FLJ41500
• antigen peptide transporter 1
• APT1
• ATP-binding cassette sub-family B member 2
• ATP-binding cassette, sub-family B (MDR/TAP), member 2
• D6S114E
• Ham1
• Peptide supply factor 1
• Peptide transporter involved in antigen processing 1
• Peptide transporter PSF1
• Peptide Transporter TAP1
• PSF1
• PSF-1
• PSF1ABC17
• Really interesting new gene 4 protein
• RING4
• RING4FLJ26666
• TAP1
• TAP1*0102N
• TAP1N
• transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• transporter associated with antigen processing
• transporter, ATP-binding cassette, major histocompatibility complex, 1
• Y3

Background

TAP1 - transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TAP1