TAO Kinase 1 Antibody (4E12)

Images

 
Western Blot: TAO Kinase 1 Antibody (4E12) [H00057551-M01] - TAOK1 monoclonal antibody (M01), clone 4E12 Western Blot analysis of TAOK1 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: TAO Kinase 1 Antibody (4E12) [H00057551-M01] - Analysis of monoclonal antibody to TAOK1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: TAO Kinase 1 Antibody (4E12) [H00057551-M01] - Detection limit for recombinant GST tagged TAOK1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
4E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAO Kinase 1 Antibody (4E12) Summary

Immunogen
TAOK1 (NP_065842, 892 a.a. ~ 1001 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
Specificity
TAOK1 (4E12)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAOK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAO Kinase 1 Antibody (4E12)

  • EC 2.7.11
  • FLJ14314
  • hKFC-B
  • hTAOK1
  • KIAA1361
  • KIAA1361STE20-like kinase PSK2
  • Kinase from chicken homolog B
  • MAP3K16
  • MAP3K16EC 2.7.11.1
  • MARK Kinase
  • MARKK
  • MARKKmicrotubule affinity regulating kinase kinase
  • PSK2
  • PSK-2
  • PSK2serine/threonine kinase TAO1
  • serine/threonine-protein kinase TAO1
  • TAO Kinase 1
  • TAO1serine/threonine protein kinase TAO1 homolog
  • TAOK1
  • Thousand and one amino acid protein 1

Background

TAOK1, a member of the Ste20 kinase family, is a TAO type protein kinase that acts as an upstream activator to MARK by phosphorylation. When activated, MARK enhances microtubule dynamics and leads to phosphorylation and detachment of tau or equivalent MAPs from microtubules. Overexpression of MARK eventually leads to microtubule breakdown and cell death, but in neuronal cells the primary effect is to allow the development of neurites during differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAO Kinase 1 Antibody (H00057551-M01) (0)

There are no publications for TAO Kinase 1 Antibody (H00057551-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAO Kinase 1 Antibody (H00057551-M01) (0)

There are no reviews for TAO Kinase 1 Antibody (H00057551-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAO Kinase 1 Antibody (H00057551-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAO Kinase 1 Products

Research Areas for TAO Kinase 1 Antibody (H00057551-M01)

Find related products by research area.

Blogs on TAO Kinase 1

There are no specific blogs for TAO Kinase 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAO Kinase 1 Antibody (4E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TAOK1
Entrez
Uniprot