TAO Kinase 1 Antibody (4E12) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse TAO Kinase 1 Antibody (4E12) - Azide and BSA Free (H00057551-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
TAOK1 (NP_065842, 892 a.a. ~ 1001 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT |
| Specificity |
TAOK1 (4E12) |
| Isotype |
IgG3 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TAOK1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TAO Kinase 1 Antibody (4E12) - Azide and BSA Free
Background
TAOK1, a member of the Ste20 kinase family, is a TAO type protein kinase that acts as an upstream activator to MARK by phosphorylation. When activated, MARK enhances microtubule dynamics and leads to phosphorylation and detachment of tau or equivalent MAPs from microtubules. Overexpression of MARK eventually leads to microtubule breakdown and cell death, but in neuronal cells the primary effect is to allow the development of neurites during differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC
Species: Hu, Mu
Applications: IHC, WB
Publications for TAO Kinase 1 Antibody (H00057551-M01) (0)
There are no publications for TAO Kinase 1 Antibody (H00057551-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TAO Kinase 1 Antibody (H00057551-M01) (0)
There are no reviews for TAO Kinase 1 Antibody (H00057551-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TAO Kinase 1 Antibody (H00057551-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TAO Kinase 1 Products
Research Areas for TAO Kinase 1 Antibody (H00057551-M01)
Find related products by research area.
|
Blogs on TAO Kinase 1