Tankyrase binding protein 1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEERSLPSDLAFNGDLAKAASSELPAD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TNKS1BP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tankyrase binding protein 1 Antibody - BSA Free
Background
TAB182 (tankyrase 1-binding protein of 182 kDa) was identified in a two-hybrid screen in search of tankyrase 1-interacting proteins. Tankyrase 1 is a poly (ADP-ribose) polymerase (PARP) that ribosylates the negative regulator of telomere length, TRF1 (telomere-repeat binding factor). Ribosylation of TRF1 has been shown to result in the inhibition of TRF1 binding and an induction of telomere elongation. TAB182 and TRF1 bind multiple discrete and overlapping sites of the tankyrase 1 ankyrin domain. This finding suggests that TAB182 may act as a scaffold to mediate higher order protein complex formation at telomeres. TAB182 has also been suggested to serve a role in the cytoplasm as it has been found to localize to the cytoplasmic cortical actin network.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Publications for Tankyrase binding protein 1 Antibody (NBP2-34041) (0)
There are no publications for Tankyrase binding protein 1 Antibody (NBP2-34041).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tankyrase binding protein 1 Antibody (NBP2-34041) (0)
There are no reviews for Tankyrase binding protein 1 Antibody (NBP2-34041).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Tankyrase binding protein 1 Antibody (NBP2-34041) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tankyrase binding protein 1 Products
Blogs on Tankyrase binding protein 1