Tankyrase binding protein 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tankyrase binding protein 1 Antibody [NBP1-89826] - Staining of human kidney, prostate, skeletal muscle and skin using Anti-TNKS1BP1 antibody NBP1-89826 (A) shows similar protein distribution across tissues to independent antibody NBP2-34041 (B).

Analysis in human skin and skeletal muscle tissues using Anti-TNKS1BP1 antibody. Corresponding TNKS1BP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Tankyrase binding protein 1 Antibody [NBP1-89826] - Staining of human skin shows high expression.

Immunohistochemistry-Paraffin: Tankyrase binding protein 1 Antibody [NBP1-89826] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Tankyrase binding protein 1 Antibody [NBP1-89826] - Staining of human prostate.

Immunohistochemistry-Paraffin: Tankyrase binding protein 1 Antibody [NBP1-89826] - Staining of human kidney.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tankyrase binding protein 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tankyrase binding protein 1 Antibody - BSA Free (NBP1-89826) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNKS1BP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tankyrase binding protein 1 Protein (NBP1-89826PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tankyrase binding protein 1 Antibody - BSA Free

• KIAA1741TAB182FLJ45975,182 kDa tankyrase-1-binding protein
• tankyrase 1 binding protein 1, 182kDa
• tankyrase 1-binding protein of 182 kDa

Background

TAB182 (tankyrase 1-binding protein of 182 kDa) was identified in a two-hybrid screen in search of tankyrase 1-interacting proteins. Tankyrase 1 is a poly (ADP-ribose) polymerase (PARP) that ribosylates the negative regulator of telomere length, TRF1 (telomere-repeat binding factor). Ribosylation of TRF1 has been shown to result in the inhibition of TRF1 binding and an induction of telomere elongation. TAB182 and TRF1 bind multiple discrete and overlapping sites of the tankyrase 1 ankyrin domain. This finding suggests that TAB182 may act as a scaffold to mediate higher order protein complex formation at telomeres. TAB182 has also been suggested to serve a role in the cytoplasm as it has been found to localize to the cytoplasmic cortical actin network.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNKS1BP1