TAF8 Antibody

Images

 
Western Blot: TAF8 Antibody [H00129685-B01P] - Analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TBN transfected lysate(19.14 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TAF8 Antibody [H00129685-B01P] - Analysis of purified antibody to TAF8 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAF8 Antibody Summary

Immunogen
TBN (AAH33728.1, 1 a.a. - 174 a.a.) full-length human protein. MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Specificity
TBN - taube nuss homolog (mouse),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TAF8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF8 Antibody

  • 45/50kDa
  • FLJ32821
  • II
  • Protein taube nuss
  • RNA polymerase II, 43 kD
  • TAF(II)43,43
  • TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, A
  • taube nuss homolog (mouse)
  • TBP-associated factor 43 kDa
  • TBP-associated factor 8
  • transcription initiation factor TFIID subunit 8

Background

This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAF8 Antibody (H00129685-B01P) (0)

There are no publications for TAF8 Antibody (H00129685-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF8 Antibody (H00129685-B01P) (0)

There are no reviews for TAF8 Antibody (H00129685-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF8 Antibody (H00129685-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF8
Entrez