TAF8 Antibody

Western Blot: TAF8 Antibody [H00129685-B01P] - Analysis of TAF8 expression in transfected 293T cell line by TAF8 polyclonal antibody. Lane 1: TBN transfected lysate(19.14 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TAF8 Antibody [H00129685-B01P] - Analysis of purified antibody to TAF8 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

TAF8 Antibody Summary

• Immunogen: TBN (AAH33728.1, 1 a.a. - 174 a.a.) full-length human protein. MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
• Specificity: TBN - taube nuss homolog (mouse),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TAF8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF8 Antibody

• 45/50kDa
• FLJ32821
• II
• Protein taube nuss
• RNA polymerase II, 43 kD
• TAF(II)43,43
• TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, A
• taube nuss homolog (mouse)
• TBP-associated factor 43 kDa
• TBP-associated factor 8
• transcription initiation factor TFIID subunit 8

Background

This gene encodes one of several TATA-binding protein (TBP)-associated factors (TAFs), which are integral subunits of the general transcription factor complex TFIID. TFIID recognizes the core promoter of many genes and nucleates the assembly of a transcription preinitiation complex containing RNA polymerase II and other initiation factors. The protein encoded by this gene contains an H4-like histone fold domain, and interacts with several subunits of TFIID including TBP and the histone-fold protein TAF10. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF8
• Entrez:
  • 129685(Human)