TAF7L Antibody - Azide and BSA Free

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TAF7L Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TAF7L Antibody - Azide and BSA Free (NBP3-04990) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 363-462 of human TAF7L (NP_079161.3). SEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF7L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TAF7L Antibody - Azide and BSA Free

• 50kDa
• CT40FLJ23157
• RNA polymerase II TBP-associated factor subunit Q
• TAF2QRNA polymerase II, Q
• TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q
• TATA box-binding protein-associated factor 50 kDa
• transcription initiation factor TFIID subunit 7-like

Background

TAF7L is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TAF7L