TAF6L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAF6L Antibody [NBP2-39083] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TAF6L Antibody [NBP2-39083] - Staining of human testis shows moderate nuclear positivity in in subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF6L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF6L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF6L Protein (NBP2-39083PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF6L Antibody

  • FLJ11136
  • p300/CBP-associated factor (PCAF)-associated factor 65
  • PAF65-alpha
  • PAF65AMGC4288
  • PCAF-associated factor 65 alpha
  • PCAF-associated factor 65-alpha
  • TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD
  • TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006879-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-82774
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-511
Species: Hu, Mu
Applications: IP, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-92902
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-80638
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-92649
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-92474
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-39083
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TAF6L Antibody (NBP2-39083) (0)

There are no publications for TAF6L Antibody (NBP2-39083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF6L Antibody (NBP2-39083) (0)

There are no reviews for TAF6L Antibody (NBP2-39083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAF6L Antibody (NBP2-39083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF6L Products

Bioinformatics Tool for TAF6L Antibody (NBP2-39083)

Discover related pathways, diseases and genes to TAF6L Antibody (NBP2-39083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TAF6L Antibody (NBP2-39083)

View related products by pathway.

PTMs for TAF6L Antibody (NBP2-39083)

Learn more about PTMs related to TAF6L Antibody (NBP2-39083).

Blogs on TAF6L

There are no specific blogs for TAF6L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF6L
Uniprot