TAF4B Recombinant Protein Antigen

Images

 
There are currently no images for TAF4B Protein (NBP1-90657PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAF4B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF4B.

Source: E.coli

Amino Acid Sequence: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT

Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAF4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-90657.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAF4B Recombinant Protein Antigen

  • TAF(II)105
  • TAF2C2
  • TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
  • TAFII105
  • TAFII-105
  • TATA box binding protein (TBP)-associated factor 4B
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD
  • transcription initiation factor TFIID 105 kD subunit
  • transcription initiation factor TFIID 105 kDa subunit
  • transcription initiation factor TFIID subunit 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-80894
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-90657PEP
Species: Hu
Applications: AC

Publications for TAF4B Protein (NBP1-90657PEP) (0)

There are no publications for TAF4B Protein (NBP1-90657PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF4B Protein (NBP1-90657PEP) (0)

There are no reviews for TAF4B Protein (NBP1-90657PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TAF4B Protein (NBP1-90657PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF4B Products

TAF4B NBP1-90657PEP

Bioinformatics Tool for TAF4B Protein (NBP1-90657PEP)

Discover related pathways, diseases and genes to TAF4B Protein (NBP1-90657PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF4B Protein (NBP1-90657PEP)

Discover more about diseases related to TAF4B Protein (NBP1-90657PEP).
 

Pathways for TAF4B Protein (NBP1-90657PEP)

View related products by pathway.

PTMs for TAF4B Protein (NBP1-90657PEP)

Learn more about PTMs related to TAF4B Protein (NBP1-90657PEP).

Blogs on TAF4B

There are no specific blogs for TAF4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAF4B Antibody
NBP1-90657
TAF4B Antibody
NBP1-90657
c-Myc Antibody
NB600-335
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAF4B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF4B