Taf4 Antibody

Images

 
There are currently no images for Taf4 Antibody (H00006874-A01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Taf4 Antibody Summary

Immunogen
TAF4 (NP_003176 715 a.a. - 800 a.a.) partial recombinant protein with GST tag. LQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGT
Specificity
TAF4 - TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TAF4
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Taf4 Antibody

  • FLJ41943
  • TAF(II)130
  • TAF(II)135
  • TAF2C1TBP-associated factor 4
  • TAF2CRNA polymerase II TBP-associated factor subunit C
  • TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF4A
  • TAFII130TAFII-130
  • TAFII135TAFII-135
  • TATA box binding protein (TBP)-associated factor, 135kD
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, C1, 130kD
  • Transcription initiation factor TFIID 130 kDa subunit
  • transcription initiation factor TFIID 135 kD subunit
  • transcription initiation factor TFIID subunit 4

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-80703
Species: Hu
Applications: WB, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Taf4 Antibody (H00006874-A01) (0)

There are no publications for Taf4 Antibody (H00006874-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Taf4 Antibody (H00006874-A01) (0)

There are no reviews for Taf4 Antibody (H00006874-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Taf4 Antibody (H00006874-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Taf4 Products

Bioinformatics Tool for Taf4 Antibody (H00006874-A01)

Discover related pathways, diseases and genes to Taf4 Antibody (H00006874-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Taf4 Antibody (H00006874-A01)

Discover more about diseases related to Taf4 Antibody (H00006874-A01).
 

Pathways for Taf4 Antibody (H00006874-A01)

View related products by pathway.

PTMs for Taf4 Antibody (H00006874-A01)

Learn more about PTMs related to Taf4 Antibody (H00006874-A01).

Blogs on Taf4

There are no specific blogs for Taf4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Taf4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF4
Entrez
OMIM
Uniprot