TAF3B1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BDP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TAF3B1 Antibody - BSA Free
Background
RNA polymerase (pol) III synthesizes tRNA, 5s rRNA, 7SL RNA and U6 snRNA and is overexpressed in many transformed cell lines and tumors in vivo, since cells must duplicate its protein components before division. Therefore, in order to maintain rapid growth, cells must produce a high level of Pol III transcribed RNA, which requires the presence of the TFIIIB and TFIIIC2 transcription factor complexes. The TFIIIC2 complex is composed of five subunits, TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, that are overexpressed in adenovirus transformed cells as well as in malignant cells in vivo, such as ovarian carcinomas. TFIIIC2 recruits RNA pol III and TFIIIB to promoter elements and may be a key component in the deregulation of malignant cells. The TFIIIB complex includes the TATA-binding protein (TBP), TFIIB-related factor 1 (TFIIIB90, BRF1) and TFIIIB, the expression of which are also upregulated in transformed cells. In many carcinomas, the tumor suppressors retinoblastoma (RB) and p53 are inactivated, which affects their ability to bind and inactivate the function of TFIIIB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for TAF3B1 Antibody (NBP3-17176) (0)
There are no publications for TAF3B1 Antibody (NBP3-17176).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TAF3B1 Antibody (NBP3-17176) (0)
There are no reviews for TAF3B1 Antibody (NBP3-17176).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TAF3B1 Antibody (NBP3-17176) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TAF3B1 Products
Blogs on TAF3B1