TAF3 Antibody - Azide and BSA Free

Western Blot: TAF3 Antibody [NBP2-93431] - Analysis of extracts of various cell lines, using TAF3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 3min.

Product Discontinued

TAF3 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF3 (NP_114129.1). HRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 103 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TAF3 Antibody - Azide and BSA Free

• 140 kDa TATA box-binding protein-associated factor
• MGC25063
• RNA polymerase II transcription factor TAFII140
• TAF(II)140
• TAF140
• TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
• TAFII140
• TAFII-140
• TBP-associated factor 3
• transcription initiation factor TFIID 140 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TAF3