TAF2 Antibody - BSA Free

Western Blot: TAF2 Antibody [NBP2-86842] - WB Suggested Anti-TAF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: 293T cell lysateTAF2 is supported by BioGPS gene expression data to be expressed in HEK293T

Chromatin Immunoprecipitation: TAF2 Antibody [NBP2-86842] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAF2 Antibody - BSA Free (NBP2-86842) is a polyclonal antibody validated for use in WB and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF2. Peptide sequence: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAF2 Antibody - BSA Free

• 150 kDa cofactor of initiator function
• CIF150TAFII-150
• cofactor of initiator function, 150kD subunit
• TAF(II)150
• TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF2B
• TAFII150RNA polymerase II TBP-associated factor subunit B
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, B, 150kD
• TBP-associated factor 150 kDa
• Transcription initiation factor TFIID 150 kDa subunit
• transcription initiation factor TFIID subunit 2

Background

TAF2 is a component of the multi-subunit TFIID transcription factor. The TFIID complex is important for coordinating the pre-initiation complex and transcription by RNA Pol II. The complex contains the TFIID protein, TATA binding protein (TBP) and multiple TBP-associated factors (TAFs). TAF2 has been shown to play an important role in gene expression required for progression through the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF2