Syntaxin-BP1 Antibody (6D1)

Images

 
Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. Antibody concentration 3 ug/ml.
Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1 Analysis of STXBP1 expression in HeLa.
Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - STXBP1 monoclonal antibody (M01), clone 6D1. Analysis of STXBP1 expression in Raw 264.7.
Western Blot: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.Lane 1: STXBP1 transfected lysate (Predicted MW: ...read more
Sandwich ELISA: Syntaxin-BP1 Antibody (6D1) [H00006812-M01] - Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Syntaxin-BP1 Antibody (6D1) Summary

Immunogen
STXBP1 (NP_003156 74 a.a. - 168 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPI
Specificity
STXBP1 (6D1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STXBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syntaxin-BP1 Antibody (6D1)

  • EIEE4
  • FLJ37475
  • hUNC18
  • MUNC18-1
  • NSEC1
  • N-Sec1
  • p67
  • Protein unc-18 homolog 1
  • Protein unc-18 homolog A
  • rbSec1
  • STXBP1
  • syntaxin binding protein 1
  • syntaxin-binding protein 1
  • SyntaxinBP1
  • Syntaxin-BP1
  • UNC18
  • unc18-1
  • UNC18A
  • unc-18A
  • UNC18neuronal SEC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006812-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P

Publications for Syntaxin-BP1 Antibody (H00006812-M01) (0)

There are no publications for Syntaxin-BP1 Antibody (H00006812-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin-BP1 Antibody (H00006812-M01) (0)

There are no reviews for Syntaxin-BP1 Antibody (H00006812-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntaxin-BP1 Antibody (H00006812-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin-BP1 Products

Bioinformatics Tool for Syntaxin-BP1 Antibody (H00006812-M01)

Discover related pathways, diseases and genes to Syntaxin-BP1 Antibody (H00006812-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin-BP1 Antibody (H00006812-M01)

Discover more about diseases related to Syntaxin-BP1 Antibody (H00006812-M01).
 

Pathways for Syntaxin-BP1 Antibody (H00006812-M01)

View related products by pathway.

PTMs for Syntaxin-BP1 Antibody (H00006812-M01)

Learn more about PTMs related to Syntaxin-BP1 Antibody (H00006812-M01).

Blogs on Syntaxin-BP1

There are no specific blogs for Syntaxin-BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin-BP1 Antibody (6D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP1
Entrez
OMIM
Uniprot