Syntaxin Binding Protein 4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Syntaxin Binding Protein 4 Antibody [NBP1-92470] - Staining of human cell line U-251MG shows positivity in cytoplasm.

Immunohistochemistry-Paraffin: Syntaxin Binding Protein 4 Antibody [NBP1-92470] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Syntaxin Binding Protein 4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALHSRIHLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STXBP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Syntaxin Binding Protein 4 Protein (NBP1-92470PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Syntaxin Binding Protein 4 Antibody - BSA Free

• FLJ16496
• MGC50337
• STX4-interacting protein
• SynipMGC149829
• syntaxin 4 interacting protein
• Syntaxin 4-interacting protein
• syntaxin binding protein 4
• syntaxin-binding protein 4

Background

Synip (Syntaxin 4-Interacting protein) specifically binds to Syntaxin 4 and is uniquely expressed in muscle and adipose tissue. The binding interaction of Synip with syntaxin 4 is regulated by insulin, which also induces dissociation of the Synip-syntaxin 4 complex. Synip plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane and functions as a positive regulator of insulin-stimulated GLUT4 translocation. Synip also competes with VAMP2 but Not SNAP23 for binding to Syntaxin 4 (1-3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STXBP4