Synaptotagmin 2 Antibody (1G10) Summary
Immunogen |
SYT2 (NP_796376, 311 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN |
Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Chromaffin granule. |
Specificity |
SYT2 - synaptotagmin II |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SYT2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Reactivity Notes
Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Synaptotagmin 2 Antibody (1G10)
Background
SYT2 (Synaptotagmin II) belongs to the synaptotagmin family of multi-domained, integral membrane proteins of synaptic vesicles which are thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Fi, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Publications for Synaptotagmin 2 Antibody (H00127833-M01) (0)
There are no publications for Synaptotagmin 2 Antibody (H00127833-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Synaptotagmin 2 Antibody (H00127833-M01) (0)
There are no reviews for Synaptotagmin 2 Antibody (H00127833-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Synaptotagmin 2 Antibody (H00127833-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Synaptotagmin 2 Products
Bioinformatics Tool for Synaptotagmin 2 Antibody (H00127833-M01)
Discover related pathways, diseases and genes to Synaptotagmin 2 Antibody (H00127833-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Synaptotagmin 2 Antibody (H00127833-M01)
Discover more about diseases related to Synaptotagmin 2 Antibody (H00127833-M01).
| | Pathways for Synaptotagmin 2 Antibody (H00127833-M01)
View related products by pathway.
|
PTMs for Synaptotagmin 2 Antibody (H00127833-M01)
Learn more about PTMs related to Synaptotagmin 2 Antibody (H00127833-M01).
| | Research Areas for Synaptotagmin 2 Antibody (H00127833-M01)
Find related products by research area.
|
Blogs on Synaptotagmin 2