Synaptotagmin 2 Antibody (1G10)

Images

 
Western Blot: Synaptotagmin 2 Antibody (1G10) [H00127833-M01] - SYT2 monoclonal antibody (M01), clone 1G10. Analysis of SYT2 expression in human kidney.
Western Blot: Synaptotagmin 2 Antibody (1G10) [H00127833-M01] - SYT2 monoclonal antibody (M01), clone 1G10 Western Blot analysis of SYT2 expression in HepG2 ( Cat # L019V1 ).
Sandwich ELISA: Synaptotagmin 2 Antibody (1G10) [H00127833-M01] - Detection limit for recombinant GST tagged SYT2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Synaptotagmin 2 Antibody (1G10) Summary

Immunogen
SYT2 (NP_796376, 311 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKN
Localization
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Chromaffin granule.
Specificity
SYT2 - synaptotagmin II
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SYT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synaptotagmin 2 Antibody (1G10)

  • FLJ42519
  • synaptotagmin 2
  • synaptotagmin IISytII
  • synaptotagmin-2

Background

SYT2 (Synaptotagmin II) belongs to the synaptotagmin family of multi-domained, integral membrane proteins of synaptic vesicles which are thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00006760-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-19320
Species: Fi, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-46045
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20857
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81588
Species: Hu
Applications: IHC, IHC-P, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP2-20522
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-82964
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-17155
Species: Hu
Applications: IHC, IHC-P
H00127833-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Synaptotagmin 2 Antibody (H00127833-M01) (0)

There are no publications for Synaptotagmin 2 Antibody (H00127833-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptotagmin 2 Antibody (H00127833-M01) (0)

There are no reviews for Synaptotagmin 2 Antibody (H00127833-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptotagmin 2 Antibody (H00127833-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptotagmin 2 Products

Bioinformatics Tool for Synaptotagmin 2 Antibody (H00127833-M01)

Discover related pathways, diseases and genes to Synaptotagmin 2 Antibody (H00127833-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 2 Antibody (H00127833-M01)

Discover more about diseases related to Synaptotagmin 2 Antibody (H00127833-M01).
 

Pathways for Synaptotagmin 2 Antibody (H00127833-M01)

View related products by pathway.

PTMs for Synaptotagmin 2 Antibody (H00127833-M01)

Learn more about PTMs related to Synaptotagmin 2 Antibody (H00127833-M01).
 

Research Areas for Synaptotagmin 2 Antibody (H00127833-M01)

Find related products by research area.

Blogs on Synaptotagmin 2

There are no specific blogs for Synaptotagmin 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptotagmin 2 Antibody (1G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT2
Entrez
OMIM
Uniprot