Synaptojanin 2 Antibody (2H8)

Images

 
Western Blot: Synaptojanin 2 Antibody (2H8) [H00008871-M02] - Analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi ( Cat # H00008871-R01V ) (Lane 2) or non-transfected control ...read more
Western Blot: Synaptojanin 2 Antibody (2H8) [H00008871-M02] - Analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody (M02), clone 2H8.Lane 1: SYNJ2 transfected lysate(92.2 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Synaptojanin 2 Antibody (2H8) Summary

Immunogen
SYNJ2 (NP_003889 1396 a.a. - 1495 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK
Localization
Membrane. Note=Predominantly associated with the particulate fractions.
Specificity
SYNJ2 - synaptojanin 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SYNJ2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Synaptojanin 2 Antibody (2H8)

  • EC 3.1.3.36
  • inositol phosphate 5'-phosphatase 2
  • INPP5H
  • KIAA0348MGC44422
  • Synaptic inositol-14,5-trisphosphate 5-phosphatase 2
  • synaptojanin 2
  • synaptojanin-2

Background

Synaptojanin-2 is a ubiquitously expressed inositol polyphosphate 5-phosphatase (Malecz et al., 2000 [PubMed 11084340]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-94158
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-88985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00008871-M02
Species: Hu
Applications: WB, ELISA, RNAi

Publications for Synaptojanin 2 Antibody (H00008871-M02) (0)

There are no publications for Synaptojanin 2 Antibody (H00008871-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptojanin 2 Antibody (H00008871-M02) (0)

There are no reviews for Synaptojanin 2 Antibody (H00008871-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptojanin 2 Antibody (H00008871-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptojanin 2 Products

Bioinformatics Tool for Synaptojanin 2 Antibody (H00008871-M02)

Discover related pathways, diseases and genes to Synaptojanin 2 Antibody (H00008871-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptojanin 2 Antibody (H00008871-M02)

Discover more about diseases related to Synaptojanin 2 Antibody (H00008871-M02).
 

Pathways for Synaptojanin 2 Antibody (H00008871-M02)

View related products by pathway.

PTMs for Synaptojanin 2 Antibody (H00008871-M02)

Learn more about PTMs related to Synaptojanin 2 Antibody (H00008871-M02).
 

Research Areas for Synaptojanin 2 Antibody (H00008871-M02)

Find related products by research area.

Blogs on Synaptojanin 2

There are no specific blogs for Synaptojanin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptojanin 2 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNJ2
Entrez
OMIM
Uniprot