Recombinant Human Synaptogyrin 3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Synaptogyrin 3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-145 of Human SYNGR3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRFGVALGLGAFLACAAFLLLDVRFQQSGGRGKTPPSPQDWGSWPLFPSHVPVGSDCLVSVMVVRPVRSHSPLSLTGC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SYNGR3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Synaptogyrin 3 Protein

  • MGC20003
  • synaptogyrin 3
  • synaptogyrin-3

Background

SYNGR3( AAH09568, 1 a.a. - 146 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB200-184
Species: Hu, Mu
Applications: WB, IP
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77101
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77371
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-90119
Species: Hu
Applications: IHC, IHC-P
NBP1-81589
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20145
Species: Hu
Applications: WB, IHC, IHC-P
AF1519
Species: Hu
Applications: WB, IHC
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00009143-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Synaptogyrin 3 Recombinant Protein (H00009143-P01) (0)

There are no publications for Synaptogyrin 3 Recombinant Protein (H00009143-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptogyrin 3 Recombinant Protein (H00009143-P01) (0)

There are no reviews for Synaptogyrin 3 Recombinant Protein (H00009143-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptogyrin 3 Recombinant Protein (H00009143-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Synaptogyrin 3 Products

Bioinformatics Tool for Synaptogyrin 3 Recombinant Protein (H00009143-P01)

Discover related pathways, diseases and genes to Synaptogyrin 3 Recombinant Protein (H00009143-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptogyrin 3 Recombinant Protein (H00009143-P01)

Discover more about diseases related to Synaptogyrin 3 Recombinant Protein (H00009143-P01).
 

Pathways for Synaptogyrin 3 Recombinant Protein (H00009143-P01)

View related products by pathway.

Research Areas for Synaptogyrin 3 Recombinant Protein (H00009143-P01)

Find related products by research area.

Blogs on Synaptogyrin 3

There are no specific blogs for Synaptogyrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Synaptogyrin 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNGR3