Recombinant Human Synapsin I GST (N-Term) Protein

Images

 
SDS-Page: Synapsin I Recombinant Protein [H00006853-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Synapsin I GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_008881) for Human Synapsin I

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SYN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Synapsin I GST (N-Term) Protein

  • SYN1
  • SYN1a
  • SYN1b
  • Synapsin 1
  • Synapsin I
  • synapsin IBrain protein 4.1
  • synapsin-1
  • SYNI

Background

Synapsin I is a neuron specific protein that is localized to nerve terminals. Synapsin Ia and Synapsin Ib are approximately 80,000 and 77,000 Daltons, respectively, and are collectively referred to as synapsin I. The synapsin protein is an excellent marker for synaptic terminals and it can be used to estimate synaptic density and or synaptogenesis. It is thought that synapsin I cross-links synaptic vesicles to the cytoskeleton and thereby limits the ability of these synaptic vesicles to move to active zones and fuse with the plasma membrane during exocytosis. In addition to their role in neurotransmission, the synapsins are also thought to play a role in synapse formation. The appearance of synapsin I immunoreactivity correlates precisely with the development of synapses in the CNS. The synapsin protein is an excellent marker for synaptic terminals and it can be used to estimate synaptic density and or synaptogenesis. The appearance of synapsin I was a precise indicator of synapse formation and that synapsin I immunocytochemistry provides a valuable tool for the study of synaptogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DBD00
Species: Hu
Applications: ELISA
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-13445
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2185
Species: Hu, Mu, Rt
Applications: IP, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB

Publications for Synapsin I Recombinant Protein (H00006853-Q01) (0)

There are no publications for Synapsin I Recombinant Protein (H00006853-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synapsin I Recombinant Protein (H00006853-Q01) (0)

There are no reviews for Synapsin I Recombinant Protein (H00006853-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synapsin I Recombinant Protein (H00006853-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Synapsin I Products

Research Areas for Synapsin I Recombinant Protein (H00006853-Q01)

Find related products by research area.

Blogs on Synapsin I.

Synapsin I, a pre-synaptic marker
Synapsin-I, also called Synapsin 1/Syn1, is an ~80 kDa protein (predicted mol. wt. 74.1 kDa) which belongs to the Synapsin family (Synapsin I, Synapsin II, Synapsin III). Synapsins are the evolutionarily conserved phospho-proteins which are associ...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Synapsin I GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYN1