ANO7 Antibody

Images

 
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Analysis in human prostate and lymph node tissues using Anti-ANO7 antibody. Corresponding ANO7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ANO7 Antibody [NBP3-17120] - Staining of human prostate shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANO7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DLLVPDIPESVEIKVKREYYLAKQALAENEVLFGTNGTKDEQPEGSELSSHWTPFTVPKASQLQQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANO7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ANO7 Antibody

  • ANO7
  • Anoctamin 7
  • Dresden transmembrane protein of the prostate
  • DTMPP
  • IPCA-5IPCA5
  • New gene expressed in prostate
  • NGEP
  • NGEPD-TMPP
  • PCANAP5
  • PCANAP5anoctamin-7
  • PCANAP5L
  • prostate cancer associated protein 5
  • prostate cancer-associated gene 5
  • Prostate cancer-associated protein 5
  • TMEM16G
  • TMEM16GDresden-transmembrane protein of the prostate
  • Transmembrane protein 16GDTMPP

Background

ANO7 may act as a calcium-activated chloride channel. May play a role in cell-cell interactions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANO7 Antibody (NBP3-17120) (0)

There are no publications for ANO7 Antibody (NBP3-17120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANO7 Antibody (NBP3-17120) (0)

There are no reviews for ANO7 Antibody (NBP3-17120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANO7 Antibody (NBP3-17120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANO7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANO7