SV2A Recombinant Protein Antigen

Images

 
There are currently no images for SV2A Protein (NBP1-82964PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SV2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SV2A.

Source: E. coli

Amino Acid Sequence: SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SV2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82964.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SV2A Recombinant Protein Antigen

  • KIAA0736
  • KIAA0736SV2
  • SV2
  • SV2A
  • synaptic vesicle glycoprotein 2A

Background

SV2A (Synaptic Vesicle protein 2A) is an integral membrane glycoproteins present in synaptic vesicles. SV2s have 12 transmembrane domains predicted by sequence analysis. There are three characterized isoforms, SV2A, SV2B and SV2C. SV2A is expressed ubiquitously throughout the brain. SV2B has a more restricted distribution with varying degrees of coexpression with SV2A. SV2C is more closely related to SV2A but shows a very restricted expression pattern. The highest expression levels were observed in phylogenetically old brain areas like pallidum, the midbrain and the olfactory bulb. SV2A is probably involved in the maintenance of a pool of synaptic vesicles competent for calcium-stimulated exocytosis. SV2A is a highly glycosylated synaptic vesicle protein with homology to transmembrane transporters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-33714
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-92462
Species: Hu
Applications: IHC,  IHC-P
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
NBP1-86239
Species: Hu
Applications: IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB300-104
Species: Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-13179
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-82964PEP
Species: Hu
Applications: AC

Publications for SV2A Protein (NBP1-82964PEP) (0)

There are no publications for SV2A Protein (NBP1-82964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SV2A Protein (NBP1-82964PEP) (0)

There are no reviews for SV2A Protein (NBP1-82964PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SV2A Protein (NBP1-82964PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SV2A Products

Blogs on SV2A

There are no specific blogs for SV2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SV2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SV2A