SUV420h1 Antibody - Azide and BSA Free

Western Blot: SUV420h1 Antibody [NBP2-94791] - Analysis of extracts of various cell lines, using SUV420h1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SUV420h1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SUV420h1 Antibody - Azide and BSA Free (NBP2-94791) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3). MNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KMT5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:200-1:2000
• Theoretical MW: 99 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SUV420h1 Antibody - Azide and BSA Free

• C630029K18Rik
• CGI85
• CGI-85
• EC 2.1.1.43
• histone-lysine N-methyltransferase SUV420H1
• KMT5B Lysine N-methyltransferase 5B
• KMT5B
• MGC118906
• MGC118909
• MGC21161
• MGC703
• Su(var)4-20 homolog 1
• suppressor of variegation 4-20 homolog 1 (Drosophila)
• Suppressor of variegation 4-20 homolog 1
• SUV420h1
• Suv4-20h1

Background

SUV420h1 encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: KMT5B