SUV420h1 Antibody - BSA Free

Western Blot: SUV420h1 Antibody [NBP1-78303] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell

Immunohistochemistry: SUV420h1 Antibody [NBP1-78303] - Paraffin Embedded Tissue: Human Skin Cellular Data: Squamous epithelial cells (arrows) Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Western Blot: SUV420h1 Antibody [NBP1-78303] - Human placenta tissue lysate.

Western Blot: SUV420h1 Antibody [NBP1-78303] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: SUV420h1 Antibody [NBP1-78303] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml

Western Blot: SUV420h1 Antibody [NBP1-78303] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SUV420h1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human SUV420H1. Peptide Sequence NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KMT5B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 99 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SUV420h1 Antibody - BSA Free

• C630029K18Rik
• CGI85
• CGI-85
• EC 2.1.1.43
• histone-lysine N-methyltransferase SUV420H1
• KMT5B Lysine N-methyltransferase 5B
• KMT5B
• MGC118906
• MGC118909
• MGC21161
• MGC703
• Su(var)4-20 homolog 1
• suppressor of variegation 4-20 homolog 1 (Drosophila)
• Suppressor of variegation 4-20 homolog 1
• SUV420h1
• Suv4-20h1

Background

SUV420h1 encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUV420h1 Antibody (NBP1-78303)(1)

Publication using NBP1-78303

• Huang L, Wang Y, Long H et al. Structural insight into H4K20 methylation on H2A.Z-nucleosome by SUV420H1 Molecular cell 2023-07-26 [PMID: 37536340]

Bioinformatics

• Gene Symbol: KMT5B
• Entrez:
  • 51111(Human)
• Uniprot:
  • Q4FZB7(Human)