SURF5 Antibody (3A9) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
SURF5 (NP_006743.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQ |
Specificity |
SURF5 - surfeit 5 (3A9) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MED22 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SURF5 Antibody (3A9)
Background
This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Publications for SURF5 Antibody (H00006837-M01) (0)
There are no publications for SURF5 Antibody (H00006837-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SURF5 Antibody (H00006837-M01) (0)
There are no reviews for SURF5 Antibody (H00006837-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SURF5 Antibody (H00006837-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SURF5 Products
Bioinformatics Tool for SURF5 Antibody (H00006837-M01)
Discover related pathways, diseases and genes to SURF5 Antibody (H00006837-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SURF5 Antibody (H00006837-M01)
Discover more about diseases related to SURF5 Antibody (H00006837-M01).
| | Pathways for SURF5 Antibody (H00006837-M01)
View related products by pathway.
|
PTMs for SURF5 Antibody (H00006837-M01)
Learn more about PTMs related to SURF5 Antibody (H00006837-M01).
|
Blogs on SURF5