SURF5 Antibody (3A9)

Images

 
There are currently no images for SURF5 Antibody (H00006837-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SURF5 Antibody (3A9) Summary

Immunogen
SURF5 (NP_006743.1, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQ
Specificity
SURF5 - surfeit 5 (3A9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MED22
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SURF5 Antibody (3A9)

  • Med24
  • mediator complex subunit 22SURF5surfeit 5
  • mediator of RNA polymerase II transcription subunit 22
  • MGC48682
  • surf-5
  • Surfeit locus protein 5

Background

This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2277
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP2-49421
Species: Hu
Applications: IHC, IHC-P
NBP2-13400
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006834-T01
Species: Hu
NBP1-83550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP2-56318
Species: Hu
Applications: ICC/IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-84377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-59448
Species: Hu
Applications: WB
H00006837-M01
Species: Hu
Applications: WB, ELISA

Publications for SURF5 Antibody (H00006837-M01) (0)

There are no publications for SURF5 Antibody (H00006837-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SURF5 Antibody (H00006837-M01) (0)

There are no reviews for SURF5 Antibody (H00006837-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SURF5 Antibody (H00006837-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SURF5 Products

Bioinformatics Tool for SURF5 Antibody (H00006837-M01)

Discover related pathways, diseases and genes to SURF5 Antibody (H00006837-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SURF5 Antibody (H00006837-M01)

Discover more about diseases related to SURF5 Antibody (H00006837-M01).
 

Pathways for SURF5 Antibody (H00006837-M01)

View related products by pathway.

PTMs for SURF5 Antibody (H00006837-M01)

Learn more about PTMs related to SURF5 Antibody (H00006837-M01).

Blogs on SURF5

There are no specific blogs for SURF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SURF5 Antibody (3A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MED22
Entrez