SUPT16H Antibody (1F1) Summary
Immunogen |
SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE |
Specificity |
suppressor of Ty 16 homolog (S. cerevisiae) |
Isotype |
IgG2b Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
SUPT16H |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against recombinant protein on ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SUPT16H Antibody (1F1)
Background
Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is the protein encoded by this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ch, Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
Publications for SUPT16H Antibody (H00011198-M04) (0)
There are no publications for SUPT16H Antibody (H00011198-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SUPT16H Antibody (H00011198-M04) (0)
There are no reviews for SUPT16H Antibody (H00011198-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for SUPT16H Antibody (H00011198-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SUPT16H Products
Bioinformatics Tool for SUPT16H Antibody (H00011198-M04)
Discover related pathways, diseases and genes to SUPT16H Antibody (H00011198-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for SUPT16H Antibody (H00011198-M04)
Discover more about diseases related to SUPT16H Antibody (H00011198-M04).
| | Pathways for SUPT16H Antibody (H00011198-M04)
View related products by pathway.
|
PTMs for SUPT16H Antibody (H00011198-M04)
Learn more about PTMs related to SUPT16H Antibody (H00011198-M04).
|
Blogs on SUPT16H