SUPT16H Antibody (1F1)

Images

 
Sandwich ELISA: SUPT16H Antibody (1F1) [H00011198-M04] - Detection limit for recombinant GST tagged SUPT16H is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SUPT16H Antibody (1F1) Summary

Immunogen
SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
Specificity
suppressor of Ty 16 homolog (S. cerevisiae)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SUPT16H
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUPT16H Antibody (1F1)

  • CDC68
  • Chromatin-specific transcription elongation factor 140 kDa subunit
  • facilitates chromatin remodeling 140 kDa subunit
  • Facilitates chromatin transcription complex subunit SPT16
  • FACT 140 kDa subunit
  • FACT complex subunit SPT16
  • FACT140
  • FACTp140
  • FACTP140FACT
  • FLJ10857
  • FLJ14010
  • FLJ34357
  • hSPT16
  • SPT16/CDC68
  • suppressor of Ty (S.cerevisiae) 16 homolog
  • suppressor of Ty 16 homolog (S. cerevisiae)

Background

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is the protein encoded by this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80439
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-64992
Species: Rt
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
H00010522-D01P
Species: Hu, Mu
Applications: WB, ICC/IF
AF6465
Species: Hu, Rt
Applications: WB, ICC
NBP2-60616
Species: Hu
H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-94643
Species: Hu, Mu, Rt
Applications: WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NB600-273
Species: Hu, Mu
Applications: WB, IP
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP, KD

Publications for SUPT16H Antibody (H00011198-M04) (0)

There are no publications for SUPT16H Antibody (H00011198-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUPT16H Antibody (H00011198-M04) (0)

There are no reviews for SUPT16H Antibody (H00011198-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SUPT16H Antibody (H00011198-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUPT16H Products

Array H00011198-M04

Bioinformatics Tool for SUPT16H Antibody (H00011198-M04)

Discover related pathways, diseases and genes to SUPT16H Antibody (H00011198-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUPT16H Antibody (H00011198-M04)

Discover more about diseases related to SUPT16H Antibody (H00011198-M04).
 

Pathways for SUPT16H Antibody (H00011198-M04)

View related products by pathway.

PTMs for SUPT16H Antibody (H00011198-M04)

Learn more about PTMs related to SUPT16H Antibody (H00011198-M04).

Blogs on SUPT16H

There are no specific blogs for SUPT16H, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUPT16H Antibody (1F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SUPT16H
Entrez
OMIM
Uniprot