SUB1 Antibody (3A1) - Azide and BSA Free

Western Blot: SUB1 Antibody (3A1) [H00010923-M11] - Analysis of SUB1 expression in IMR-32.

Immunocytochemistry/Immunofluorescence: SUB1 Antibody (3A1) [H00010923-M11] - Analysis of monoclonal antibody to SUB1 on HeLa cell. Antibody concentration 10 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3A1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SUB1 Antibody (3A1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SUB1 Antibody (3A1) - Azide and BSA Free (H00010923-M11) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SUB1 (AAH09610.1, 32 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAV
• Specificity: SUB1 - SUB1 homolog (S. cerevisiae) (3A1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SUB1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUB1 Antibody (3A1) - Azide and BSA Free

• activated RNA polymerase II transcription cofactor 4
• activated RNA polymerase II transcriptional coactivator p15
• MGC102747
• p15
• PC4p14P15
• Positive cofactor 4
• RPO2TC1
• SUB1 homolog (S. cerevisiae)
• SUB1 homolog

Background

PC4 is a multifunctional transcriptional coactivator that plays an important role in transcription, repair, and replication. PC4 interacts with general transcription factors, DNA repair factors, and mRNA processing factors to influence transcription initiation, coactivation, polyadenylation, transcription termination, and transcriptional repression. PC4 has been demonstrated to be a DNA binding protein and a bona fide component of chromatin with chromatin-compacting ability. Alternate names for PC4 include activated RNA polymerase II transcriptional coactivator p15, SUB1 homolog, positive cofactor 4, p14, SUB1, RPO2TC1, and MGC102747.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUB1
• Entrez:
  • 10923(Human)
• Uniprot:
  • AAH09610(Human)