STRA6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STRA6 Antibody [NBP1-83719] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: STRA6 Antibody [NBP1-83719] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STRA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STRA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STRA6 Protein (NBP1-83719PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STRA6 Antibody

  • FLJ12541
  • MCOPS9
  • stimulated by retinoic acid gene 6 homolog (mouse)
  • stimulated by retinoic acid gene 6 protein homolog
  • STRA6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-92280
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
AF2988
Species: Mu, Rt
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59023
Species: Hu
Applications: WB
H00056603-M01
Species: Hu
Applications: WB, ELISA
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83719
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for STRA6 Antibody (NBP1-83719) (0)

There are no publications for STRA6 Antibody (NBP1-83719).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STRA6 Antibody (NBP1-83719) (0)

There are no reviews for STRA6 Antibody (NBP1-83719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STRA6 Antibody (NBP1-83719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STRA6 Products

Bioinformatics Tool for STRA6 Antibody (NBP1-83719)

Discover related pathways, diseases and genes to STRA6 Antibody (NBP1-83719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STRA6 Antibody (NBP1-83719)

Discover more about diseases related to STRA6 Antibody (NBP1-83719).
 

Pathways for STRA6 Antibody (NBP1-83719)

View related products by pathway.

PTMs for STRA6 Antibody (NBP1-83719)

Learn more about PTMs related to STRA6 Antibody (NBP1-83719).

Blogs on STRA6

There are no specific blogs for STRA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STRA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STRA6
Entrez