STK40 Antibody (4G3) - Azide and BSA Free

Western Blot: STK40 Antibody (4G3) [H00083931-M04] - STK40 monoclonal antibody (M04), clone 4G3. Western Blot analysis of STK40 expression in HepG2 ( Cat # L019V1 ).

Immunohistochemistry-Paraffin: STK40 Antibody (4G3) [H00083931-M04] - Analysis of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4G3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

STK40 Antibody (4G3) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse STK40 Antibody (4G3) - Azide and BSA Free (H00083931-M04) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: STK40 (NP_114406, 349 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR
• Specificity: STK40 - serine/threonine kinase 40 (4G3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: STK40
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK40 Antibody (4G3) - Azide and BSA Free

• 2310004N11Rik
• EC 2.7.11
• EC 2.7.11.1
• MGC4796
• Ser/Thr-like kinase
• serine/threonine kinase 40
• serine/threonine-protein kinase 40
• SGK495
• SgK495SHIKRP11-268J15.4
• SINK-homologous serine/threonine-protein kinase
• Sugen kinase 495

Background

STK40 may be a negative regulator of NF-kappa-B and p53-mediated gene transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK40
• Entrez:
  • 83931(Human)
• Uniprot:
  • NP_114406(Human)