![Western Blot: STK40 Antibody (4G3) [H00083931-M04] - STK40 monoclonal antibody (M04), clone 4G3. Western Blot analysis of STK40 expression in HepG2 ( Cat # L019V1 ).](http://images.novusbio.com/fullsize/STK40-Antibody-4G3-Western-Blot-H00083931-M04-img0001.jpg "Western Blot: STK40 Antibody (4G3) [H00083931-M04] - STK40 monoclonal antibody (M04), clone 4G3. Western Blot analysis of STK40 expression in HepG2 ( Cat # L019V1 ).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4G3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | STK40 (NP_114406, 349 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR |
| Specificity | STK40 - serine/threonine kinase 40 (4G3) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STK40 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for STK40 Antibody (H00083931-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: STK40 Antibody (4G3) [H00083931-M04] - Analysis of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/STK40-Antibody-4G3-Immunohistochemistry-Paraffin-H00083931-M04-img0002.jpg "Immunohistochemistry-Paraffin: STK40 Antibody (4G3) [H00083931-M04] - Analysis of monoclonal antibody to STK40 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![N/A LIX [Biotin]](https://images.novusbio.com/images2/DATA_LIX_DY443_ELISA_2033.jpg)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020121349.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122737.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122919.png)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A CXCL1/GRO alpha/KC/CINC-1 [Biotin]](https://images.novusbio.com/images2/DATA_CXCL1_DY453_ELISA_2039.jpg)
![Western Blot Tyk2 Antibody (307214) [Unconjugated]](https://images.novusbio.com/images2/Tyk2_MAB3427_Western_Blot_6105.jpg)
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
