STK39 Recombinant Protein Antigen

Images

 
There are currently no images for STK39 Recombinant Protein Antigen (NBP2-49373PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STK39 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK39.

Source: E. coli

Amino Acid Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK39
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-49373.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STK39 Recombinant Protein Antigen

  • DCHTsmall intestine SPAK-like kinase
  • DKFZp686K05124
  • EC 2.7.11
  • EC 2.7.11.1
  • PASK
  • proline-alanine-rich STE20-related kinase
  • serine threonine kinase 39
  • Serine/threonine-protein kinase 39
  • SPAKserine threonine kinase 39 (STE20/SPS1 homolog, yeast)
  • STE20/SPS1 homolog
  • STE20/SPS1-related proline-alanine-rich protein kinase
  • Ste20-like protein kinase
  • Ste-20-related kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00130497-M10
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P, IP
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94269
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82874
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB4866
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-49373PEP
Species: Hu
Applications: AC

Publications for STK39 Recombinant Protein Antigen (NBP2-49373PEP) (0)

There are no publications for STK39 Recombinant Protein Antigen (NBP2-49373PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK39 Recombinant Protein Antigen (NBP2-49373PEP) (0)

There are no reviews for STK39 Recombinant Protein Antigen (NBP2-49373PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STK39 Recombinant Protein Antigen (NBP2-49373PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional STK39 Products

Bioinformatics Tool for STK39 Recombinant Protein Antigen (NBP2-49373PEP)

Discover related pathways, diseases and genes to STK39 Recombinant Protein Antigen (NBP2-49373PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK39 Recombinant Protein Antigen (NBP2-49373PEP)

Discover more about diseases related to STK39 Recombinant Protein Antigen (NBP2-49373PEP).
 

Pathways for STK39 Recombinant Protein Antigen (NBP2-49373PEP)

View related products by pathway.

PTMs for STK39 Recombinant Protein Antigen (NBP2-49373PEP)

Learn more about PTMs related to STK39 Recombinant Protein Antigen (NBP2-49373PEP).
 

Research Areas for STK39 Recombinant Protein Antigen (NBP2-49373PEP)

Find related products by research area.

Blogs on STK39

There are no specific blogs for STK39, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WNK4 Antibody
NB600-284

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK39 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK39