STK25 Antibody

Images

 
Western Blot: STK25 Antibody [NBP1-69059] - Titration: 0.2-1 ug/ml, Positive Control: Rat Heart.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK25 Antibody Summary

Immunogen
Synthetic peptides corresponding to Stk25 (serine/threonine kinase 25 (STE20 homolog, yeast)) The peptide sequence was selected from the C terminal of Stk25. Peptide sequence TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Stk25 and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STK25 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 25 (Ste20, yeast homolog)
  • serine/threonine kinase 25
  • serine/threonine-protein kinase 25
  • SOK-1
  • SOK1DKFZp686J1430
  • Ste20, yeast homolog
  • Ste20/oxidant stress response kinase 1
  • sterile 20 (oxidant stress response kinase 1; yeast Sps1/Ste20-related kinase1)
  • Sterile 20/oxidant stress-response kinase 1
  • YSK1yeast)

Background

The function of Stk25 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NB100-56139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00051765-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-83024
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-69059
Species: Rt
Applications: WB

Publications for STK25 Antibody (NBP1-69059) (0)

There are no publications for STK25 Antibody (NBP1-69059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK25 Antibody (NBP1-69059) (0)

There are no reviews for STK25 Antibody (NBP1-69059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STK25 Antibody (NBP1-69059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK25 Products

Bioinformatics Tool for STK25 Antibody (NBP1-69059)

Discover related pathways, diseases and genes to STK25 Antibody (NBP1-69059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK25 Antibody (NBP1-69059)

Discover more about diseases related to STK25 Antibody (NBP1-69059).
 

Pathways for STK25 Antibody (NBP1-69059)

View related products by pathway.

PTMs for STK25 Antibody (NBP1-69059)

Learn more about PTMs related to STK25 Antibody (NBP1-69059).

Blogs on STK25

There are no specific blogs for STK25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK25
Uniprot