STIM2 Antibody

Images

 
Immunohistochemistry: STIM2 Antibody [NBP2-37964] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STIM2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHS
Specificity
Specificity of human STIM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STIM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STIM2 Protein (NBP2-37964PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STIM2 Antibody

  • FLJ39527
  • KIAA1482
  • stromal interaction molecule 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006786-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77283
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NBP1-93523
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-04611
Species: Hu
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB400-140
Species: Hu, Rb, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-66228
Species: Hu
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF009
Species: Hu
Applications: WB, IHC
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP2-37964
Species: Hu
Applications: IHC, IHC-P

Publications for STIM2 Antibody (NBP2-37964) (0)

There are no publications for STIM2 Antibody (NBP2-37964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STIM2 Antibody (NBP2-37964) (0)

There are no reviews for STIM2 Antibody (NBP2-37964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STIM2 Antibody (NBP2-37964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for STIM2 Antibody (NBP2-37964)

Discover related pathways, diseases and genes to STIM2 Antibody (NBP2-37964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STIM2 Antibody (NBP2-37964)

Discover more about diseases related to STIM2 Antibody (NBP2-37964).
 

Pathways for STIM2 Antibody (NBP2-37964)

View related products by pathway.

PTMs for STIM2 Antibody (NBP2-37964)

Learn more about PTMs related to STIM2 Antibody (NBP2-37964).

Blogs on STIM2

There are no specific blogs for STIM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STIM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STIM2
Uniprot