Recombinant Human STEAP2 Protein

Images

 
SDS-Page: STEAP2 Recombinant Protein [H00261729-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STEAP2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 490 of Human STEAP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
STEAP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STEAP2 Protein

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Background

This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76822
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-80831
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13395
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-47384
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00261729-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for STEAP2 Recombinant Protein (H00261729-P01) (0)

There are no publications for STEAP2 Recombinant Protein (H00261729-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Recombinant Protein (H00261729-P01) (0)

There are no reviews for STEAP2 Recombinant Protein (H00261729-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STEAP2 Recombinant Protein (H00261729-P01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Additional STEAP2 Products

STEAP2 H00261729-P01

Bioinformatics Tool for STEAP2 Recombinant Protein (H00261729-P01)

Discover related pathways, diseases and genes to STEAP2 Recombinant Protein (H00261729-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP2 Recombinant Protein (H00261729-P01)

Discover more about diseases related to STEAP2 Recombinant Protein (H00261729-P01).
 

Pathways for STEAP2 Recombinant Protein (H00261729-P01)

View related products by pathway.

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STEAP2 Antibody
NBP1-76823

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STEAP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP2
Entrez