STEAP2 Recombinant Protein Antigen

Images

 
There are currently no images for STEAP2 Protein (NBP1-83100PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STEAP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STEAP2.

Source: E. coli

Amino Acid Sequence: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STEAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83100.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STEAP2 Recombinant Protein Antigen

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Background

STEAP2 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48437
Species: Hu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NB100-68162
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP2-13395
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
5829-ST
Species: Hu
Applications: EnzAct
NBP3-04803
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
375-TL
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
AF7109
Species: Mu
Applications: IHC, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB

Publications for STEAP2 Protein (NBP1-83100PEP) (0)

There are no publications for STEAP2 Protein (NBP1-83100PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Protein (NBP1-83100PEP) (0)

There are no reviews for STEAP2 Protein (NBP1-83100PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STEAP2 Protein (NBP1-83100PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Additional STEAP2 Products

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STEAP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP2