STEAP2 Antibody Blocking Peptide

• Reactivity: Hu
• Applications: AC
• Concentration: 0.2 mg/ml

STEAP2 Antibody Blocking Peptide Summary

• Description: A blocking peptide containing 16 amino acids near the carboxy terminus of human STEAP2.

  Source: Synthetic

  (Accession #: Q8NFT2)

• Source: Synthetic
• Protein/Peptide Type: Antibody Blocking Peptide
• Gene: STEAP2
• Purity: N/A

Applications/Dilutions

• Dilutions:
  • Antibody Competition
• Application Notes: This peptide is useful as a blocking peptide for NBP1-76823.
  
  For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin.
• Preservative: 0.02% Sodium Azide
• Concentration: 0.2 mg/ml
• Purity: N/A

Alternate Names for STEAP2 Antibody Blocking Peptide

• EC 1.16.1
• EC 1.16.1.-
• IPCA1
• metalloreductase STEAP2
• PCANAP1
• PCANAP1STMP
• prostate cancer associated protein 1
• Prostate cancer-associated protein 1
• Protein upregulated in metastatic prostate cancer
• PUMPCn
• six transmembrane epithelial antigen of prostate 2
• six transmembrane epithelial antigen of the prostate 2
• Six-transmembrane epithelial antigen of prostate 2
• SixTransMembrane protein of prostate 1
• STAMP1
• STAMP1IPCA-1
• STEAP2
• STMP

Background

STEAP2 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for STEAP2 Peptide (NBP1-76823PEP). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
   • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Bioinformatics

• Gene Symbol: STEAP2