STEAP2 Blocking Peptide

Images

 
There are currently no images for STEAP2 Peptide (NBP1-76823PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC
Concentration
0.2 mg/ml

Order Details

STEAP2 Blocking Peptide Summary

Description
A blocking peptide containing 16 amino acids near the carboxy terminus of human STEAP2.

Source: Synthetic

(Accession #: Q8NFT2)

Source
Synthetic
Protein/Peptide Type
Blocking Peptide
Gene
STEAP2
Purity
N/A

Applications/Dilutions

Application Notes
Can be used to block the binding of NBP1-76823

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS pH 7.2 (10 mM NaH2PO4, 10 mM Na2HPO4, 130 mM NaCl) containing 0.1% bovine serum albumin.
Preservative
0.02% Sodium Azide
Concentration
0.2 mg/ml
Purity
N/A

Alternate Names for STEAP2 Blocking Peptide

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07094
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PAGE
NB100-68162
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IM
NBP2-13395
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47384
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76823PEP
Species: Hu
Applications: AC

Publications for STEAP2 Peptide (NBP1-76823PEP) (0)

There are no publications for STEAP2 Peptide (NBP1-76823PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Peptide (NBP1-76823PEP) (0)

There are no reviews for STEAP2 Peptide (NBP1-76823PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STEAP2 Peptide (NBP1-76823PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Other Available Formats

Additional STEAP2 Products

Array NBP1-76823PEP

Bioinformatics Tool for STEAP2 Peptide (NBP1-76823PEP)

Discover related pathways, diseases and genes to STEAP2 Peptide (NBP1-76823PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP2 Peptide (NBP1-76823PEP)

Discover more about diseases related to STEAP2 Peptide (NBP1-76823PEP).
 

Pathways for STEAP2 Peptide (NBP1-76823PEP)

View related products by pathway.

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STEAP2 Blocking Peptide and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP2