Human STEAP2 ELISA Kit (Colorimetric)

Images

 
ELISA: Human STEAP2 ELISA Kit (Colorimetric) [NBP3-40542] - Standard Curve Reference

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Suitable Sample Type
Tissue homogenates, cell lysates and other biological fluids
Standard Curve Range
0.156 - 10 ng/mL (example only; lot dependent)
Sensitivity
0.062 ng/mL (example only; lot dependent)

Order Details

Human STEAP2 ELISA Kit (Colorimetric) Summary

Description
Assay Length: 4.5 hours
Standard Curve Range
0.156 - 10 ng/mL (example only; lot dependent)
Sensitivity
0.062 ng/mL (example only; lot dependent)
Assay Type
Sandwich ELISA
Inter-Assay
%CV < 12 (example only; lot dependent)
Intra-Assay
%CV < 10 (example only; lot dependent)
Sample Volume
100 uL
Kit Type
ELISA Kit (Colorimetric)
Gene
STEAP2

Applications/Dilutions

Dilutions
  • ELISA

Packaging, Storage & Formulations

Storage
Storage of components varies. See protocol for specific instructions.

Kit Components

Components
  1. Detection Reagent A
  2. Detection Reagent B
  3. Diluent Buffer
  4. Instruction manual
  5. Plate sealer for 96 wells
  6. Pre-coated 96T strip plate
  7. Standard
  8. Stop Solution
  9. TMB Substrate
  10. Wash Buffer (30 x concentrate)

Alternate Names for Human STEAP2 ELISA Kit (Colorimetric)

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • PCANAP1
  • PCANAP1STMP
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STAMP1IPCA-1
  • STEAP2
  • STMP

Background

STEAP2 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. ELISA Kits are guaranteed for 6 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-48437
Species: Hu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NB100-68162
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP2-13395
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
5829-ST
Species: Hu
Applications: EnzAct
NBP3-04803
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
375-TL
Species: Hu
Applications: BA
DKK300
Species: Hu
Applications: ELISA
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF7109
Species: Mu
Applications: IHC, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB

Publications for STEAP2 ELISA Kit (NBP3-40542) (0)

There are no publications for STEAP2 ELISA Kit (NBP3-40542).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 ELISA Kit (NBP3-40542) (0)

There are no reviews for STEAP2 ELISA Kit (NBP3-40542). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STEAP2 ELISA Kit (NBP3-40542). (Showing 1 - 2 of 2 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
  2. What is the difference between the Quantikine and Duoset ELISA kits?
    • Our Quantikine kits are fully optimized and validated for the sample types listed on the product specific webpage and datasheet, as this can vary between kits. Each kit is supplied ready to use with one pre-coated 96-well plate, a detection antibody directly conjugated to HRP, and all other necessary reagents. These kits are ideal for researchers who want the convenience of a ready to use and optimized ELISA product. Some of these kits are also available prepackaged in larger 6 and 50 plate sizes.Our DuoSet Kits, in contrast, are ELISA development kits containing the capture and detection antibody, the mass-value calibrated standard, and streptavidin-HRP to prepare approximately 5 or 15 plates. Ancillary reagents will need to be used/purchased, and for most kits, we will recommend one of our Ancillary Reagent Kits, which contain the reagents we use ourselves in-house. DuoSet kits are validated only for cell culture supernatant samples and therefore require further development and validation for accurate measurement in more complex samples such as serum and plasma. Our DuoSet Kits offer an economical, flexible alternative for the experienced ELISA user.

Additional STEAP2 Products

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Review this Product

Be the first to review our Human STEAP2 ELISA Kit (Colorimetric) and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP2