Human STEAP2 - Ready-To-Use ELISA Kit (Colorimetric) Summary
| Description |
The Ready-To-Use ELISA kit offers pre-diluted detection reagents and a shorter experimental time. Assay Length: 3 hours |
| Standard Curve Range |
0.156 - 10 ng/mL (example only; lot dependent) |
| Sensitivity |
0.062 ng/mL (example only; lot dependent) |
| Assay Type |
Sandwich ELISA |
| Inter-Assay |
%CV < 12 (example only; lot dependent) |
| Intra-Assay |
%CV < 10 (example only; lot dependent) |
| Sample Volume |
100 uL |
| Kit Type |
ELISA Kit (Colorimetric) |
| Gene |
STEAP2 |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Storage of components varies. See protocol for specific instructions. |
Kit Components
|
Components
|
- Detection Solution A
- Detection Solution B
- Instruction manual
- Plate sealer for 96 wells
- Pre-coated 96T strip plate
- Standard Diluent
- Standard
- Stop Solution
- TMB Substrate
- Wash Buffer (30 x concentrate)
|
Alternate Names for Human STEAP2 - Ready-To-Use ELISA Kit (Colorimetric)
Background
STEAP2 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. ELISA Kits are
guaranteed for 6 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, PEP-ELISA, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Publications for STEAP2 ELISA Kit (NBP3-40541) (0)
There are no publications for STEAP2 ELISA Kit (NBP3-40541).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STEAP2 ELISA Kit (NBP3-40541) (0)
There are no reviews for STEAP2 ELISA Kit (NBP3-40541).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for STEAP2 ELISA Kit (NBP3-40541). (Showing 1 - 2 of 2 FAQ).
-
I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
- We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?
-
What is the difference between the Quantikine and Duoset ELISA kits?
- Our Quantikine kits are fully optimized and validated for the sample types listed on the product specific webpage and datasheet, as this can vary between kits. Each kit is supplied ready to use with one pre-coated 96-well plate, a detection antibody directly conjugated to HRP, and all other necessary reagents. These kits are ideal for researchers who want the convenience of a ready to use and optimized ELISA product. Some of these kits are also available prepackaged in larger 6 and 50 plate sizes.Our DuoSet Kits, in contrast, are ELISA development kits containing the capture and detection antibody, the mass-value calibrated standard, and streptavidin-HRP to prepare approximately 5 or 15 plates. Ancillary reagents will need to be used/purchased, and for most kits, we will recommend one of our Ancillary Reagent Kits, which contain the reagents we use ourselves in-house. DuoSet kits are validated only for cell culture supernatant samples and therefore require further development and validation for accurate measurement in more complex samples such as serum and plasma. Our DuoSet Kits offer an economical, flexible alternative for the experienced ELISA user.
Additional STEAP2 Products
Blogs on STEAP2