STAU2 Antibody [mFluor Violet 500 SE]

Product Discontinued

STAU2 Antibody [mFluor Violet 500 SE] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).
  
  Sequence:
  PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAU2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for STAU2 Antibody [mFluor Violet 500 SE]

• DKFZp781K0371,39K2
• double-stranded RNA-binding protein Staufen homolog 2,39K3
• MGC119606
• staufen (Drosophila, RNA-binding protein) homolog 2
• staufen homolog 2
• staufen, RNA binding protein, homolog 2 (Drosophila)

Background

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAU2