STAU2 Antibody [DyLight 650]

Product Discontinued

STAU2 Antibody [DyLight 650] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human STAU2 (NP_001157852.1).
  
  Sequence:
  PEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAU2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for STAU2 Antibody [DyLight 650]

• DKFZp781K0371,39K2
• double-stranded RNA-binding protein Staufen homolog 2,39K3
• MGC119606
• staufen (Drosophila, RNA-binding protein) homolog 2
• staufen homolog 2
• staufen, RNA binding protein, homolog 2 (Drosophila)

Background

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAU2