ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4
  
  

  Source: E.coli

  Amino Acid Sequence: PSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ST8SIA4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25159It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen

• Alpha-2,8-sialyltransferase 8D
• CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase
• CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
• EC 2.4.99
• EC 2.4.99.-
• polysialyltransferase-1
• PST1
• PST1MGC61459
• PSTMGC34450
• sialyltransferase 8 (alpha-2, 8-polysialytransferase) D
• Sialyltransferase 8D
• Sialytransferase St8Sia IV
• SIAT8D
• SIAT8-D
• ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
• ST8SIA4
• ST8SIAIV
• ST8SIA-IV

Background

The protein encoded by the ST8SIA4 gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST8SIA4